[AlexoTech] Transthyretin (Wild Type) (1.0mg) Human, Recombinant

어스바이오는 AlexoTech 한국 공식 대리점으로서 모든 제품을 전문적으로 취급 및 공급하고 있습니다.
AlexoTech의 Peptides and Proteins 제품을 소개드립니다.
 

Transthyretin, TTR은 과거에 Prealbumin으로 불렸으며, 체내에서 갑상선 호르몬인 Thyroxine과 Retinol-Binding Protein, RBP을 결합하고 운반하는 역할을 합니다.

TTR 유전자에 발생한 돌연변이는 Familial Amyloidotic Polyneuropathy, FAP과 연관되어 있으며, 이 질환은 치명적인 질병으로 심장, 간, 신장을 포함한 내장 기관에 amyloid deposition이 축적되는 것이 특징입니다.

한편, wild type TTR 역시 노년기에 발병하는 Senile Systemic Amyloidosis과 관련이 있으며, 이는 80세 이상 인구의 약 25%에서 발생하고, 주로 심장에 아밀로이드 침착이 나타나는 것이 특징입니다.
 

Product Information:

• Article no.: T-500-10
• Amount: 1mg
• Format: Lyophilized
• Molecular Weight: 13761.41 Da
• Sequence: GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKV
• Purity: 95% by Chromatography and SDS-PAGE
• Counter Ion: Ammonium Carbonate
• Storage: Store at -20°C upon arrival.
• Solubility: The lyophilized protein is readily soluble in PBS pH 7.4.

---

어스바이오(USBIO)는 AlexoTech 한국 공식 대리점입니다.
해당 제품에 대한 문의나 AlexoTech 제품의 견적 또는 문의사항이 있으시면 아래로 연락주시기 바랍니다.
Tel : 02-862-2816 / email : bio@usbio.co.kr